PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A13G2030
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 300aa    MW: 34055.1 Da    PI: 6.6558
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A13G2030genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.65.2e-171462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+d+++++G+g +W + +++ g++R++k+c++rw++yl
      Gh_A13G2030 14 KGPWSPEEDSKLKDYIEKYGTGgNWIALPQKAGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding38.52.6e-1269111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +T +Ed ++  +++  G++ W+ Ia+ ++ gRt++++k++w++
      Gh_A13G2030  69 GEFTDDEDRIICTLFASIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      78*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.442962IPR017930Myb domain
SuperFamilySSF466891.8E-2711109IPR009057Homeodomain-like
SMARTSM007178.2E-131364IPR001005SANT/Myb domain
PfamPF002499.7E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.4E-251569IPR009057Homeodomain-like
CDDcd001671.37E-91662No hitNo description
PROSITE profilePS5129422.21163117IPR017930Myb domain
SMARTSM007176.6E-1267115IPR001005SANT/Myb domain
PfamPF002496.2E-1169111IPR001005SANT/Myb domain
CDDcd001672.88E-870113No hitNo description
Gene3DG3DSA:1.10.10.604.4E-2370117IPR009057Homeodomain-like
SuperFamilySSF1014475.49E-5131140No hitNo description
SuperFamilySSF1014475.49E-5175202No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDSKLKDYIE KYGTGGNWIA LPQKAGLKRC GKSCRLRWLN  60
YLRPNIKHGE FTDDEDRIIC TLFASIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLLAM  120
NGIPSQPQRK PPPPPPPPPP FSHQPQPVSS LYEDSTAYYY TPFEPIMSSA QSDLLNNTNL  180
TNNSSLIQTP ESLFSHMQYH PMRDNFLMYG GEPSCSSSDG SYGKEMKQED HMGFQGFGAS  240
LDYGTNNGVN QWIEKQSGYN GECPLDYNLE DVKRLISSNN NSFFIDENDT QDKAMYCYYY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26141177108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0527210.0KM052721.1 Gossypium hirsutum RAX-like transcription factor RAX2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461896.10.0PREDICTED: transcription factor RAX2-like
TrEMBLA0A089N9360.0A0A089N936_G
STRINGPOPTR_0004s22490.11e-120(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.16e-78myb domain protein 36